PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0681s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 821aa    MW: 88982.8 Da    PI: 7.8399
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0681s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-095866231954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  SapurV1A.0681s0020.1.p 586 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 623
                             664459******************************88 PP

2BELL118.62.8e-38446517172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             +r e+q++k+kLls+++eVd+rY++y+eq+q+v++sF+ v g g+a pYt+lA+ka+SrhFrcLkda+a q+
  SapurV1A.0681s0020.1.p 446 DRIEHQRRKVKLLSMIDEVDRRYNHYCEQMQMVVNSFDLVLGFGAAVPYTALAQKAMSRHFRCLKDAVAAQL 517
                             589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-80379515IPR006563POX domain
PfamPF075266.5E-51384514IPR006563POX domain
PROSITE profilePS5007112.568564627IPR001356Homeobox domain
CDDcd000864.53E-13567628No hitNo description
SMARTSM003891.2E-9567631IPR001356Homeobox domain
SuperFamilySSF466893.85E-17569634IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28570633IPR009057Homeodomain-like
PfamPF059204.2E-18584623IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MGIATAPPFP PILPQYSKTH HQLSSPILQN TKSSTSNYNS MSQDYHQGIF SFSNGGFERP  60
SVSHQEHVQQ QQHHIAQQIR RDKLRVQSGY EQPPPALLGI EEEESGGLPV YETAGMLSEM  120
FNFPPAGGPA AAVDLLDQPL RSNYRTQTRQ QQPVTTNDWY NSNNRQGMVV GGLGIGNSKN  180
HSNTDSRESL ARHQHQISGI NADSAAAMQL FLMNPSQPRS PQSPSLSHHQ PPPSTSSTLH  240
MLLPNPSSSL QGFSTVSGGG YGATSVISPP QFTWVPDSSH EGGNTGAPLS NPAEISGVVE  300
AQGLSLSLSS SLQHLEAAKA EELRMGDSGL LYYNQGAGGS SSSTYYKNLG GHQHHQALHL  360
QGGMGQNHHQ VHAGFGSSLG VVKVLRNSKY VKAAQELLEE FCSVGRGQFK KSKFGRQNTN  420
PSSNNNPGGG GSSSSTKDFP PLSAADRIEH QRRKVKLLSM IDEVDRRYNH YCEQMQMVVN  480
SFDLVLGFGA AVPYTALAQK AMSRHFRCLK DAVAAQLKHS CELLGDKDGA GTSGITKGET  540
PRLKLLEQSL RQQRAFHQMG MMEQEAWRPQ RGLPERSVNI LRAWLFEHFL HPYPSDADKH  600
LLARQTGLSR NQVSNWFINA RVRLWKPMVE EMYQQESKEE EPGADDRERK QASNNNGVAQ  660
TPTPTTTTTG SSAPAATATT MPSGKRSEIN ASENDPSLLA INRQCFSENQ TKLSTSSSTT  720
TTTIITPTNI TSTAEVAPPS HAGQPFHDFA DDTCRHGSMI TADYGTTSSN ANAGAEHIGS  780
TLLRFGTTTA GDVSLTLGLR HAGKMPEKSP PFSVRDFGGC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16573631563Homeobox protein Meis2
3k2a_B1e-16573631563Homeobox protein Meis2
4xrm_A1e-16573631563Homeobox protein Meis2
4xrm_B1e-16573631563Homeobox protein Meis2
4xrs_A1e-16573630158Homeobox protein Meis1
4xrs_B1e-16573630158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2277980.0CU227798.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025689.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW800.0BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLB9HEL70.0B9HEL7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-149BEL1-like homeodomain 2